MCM3 anticorps (C-Term)

N° du produit ABIN634088

Détail du produit anti-MCM3 anticorps

Antigène: MCM3 (Minichromosome Maintenance Complex Component 3 (MCM3))

Épitope: C-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MCM3 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificité: MCM3 antibody was raised against the C terminal of MCM3

Purification: Affinity purified

Immunogène: MCM3 antibody was raised using the C terminal of MCM3 corresponding to a region with amino acids SQEDQEQKRKRRKTRQPDAKDGDSYDPYDFSDTEEEMPQVHTPKTADSQE

Information d'application

Indications d'application: WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MCM3 Blocking Peptide, catalog no. 33R-8710, is also available for use as a blocking control in assays to test for specificity of this MCM3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MCM3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MCM3

Antigène: MCM3 (Minichromosome Maintenance Complex Component 3 (MCM3))

Autre désignation: MCM3 (MCM3 Produits)

Synonymes: anticorps HCC5, anticorps P1-MCM3, anticorps P1.h, anticorps RLFB, anticorps AL033361, anticorps C80350, anticorps Mcmd, anticorps P1, anticorps p1.m, anticorps cb32, anticorps chunp6867, anticorps wu:fa26g03, anticorps CG4206, anticorps DmMCM3, anticorps DmMcm3, anticorps DmeMCM3, anticorps Dmel\\CG4206, anticorps MCM3, anticorps McM3, anticorps Mcp-PCR2, anticorps PCR2, anticorps dMCM3, anticorps xmcm3, anticorps minichromosome maintenance complex component 3, anticorps MCM3 minichromosome maintenance deficient 3 (S. cerevisiae), anticorps Minichromosome maintenance 3, anticorps minichromosome maintenance complex component 3 L homeolog, anticorps MCM complex subunit Mcm3, anticorps MCM3, anticorps mcm3, anticorps Mcm3, anticorps mcm3.L

Sujet: MCM3 is one of the highly conserved mini-chromosome maintenance proteins (MCM) that are involved in the initiation of eukaryotic genome replication. The hexameric protein complex formed by MCM proteins is a key component of the pre-replication complex (pre_RC) and may be involved in the formation of replication forks and in the recruitment of other DNA replication related proteins. This protein is a subunit of the protein complex that consists of MCM2-7. It has been shown to interact directly with MCM5/CDC46. This protein also interacts with, and thus is acetlyated by MCM3AP, a chromatin-associated acetyltransferase. The acetylation of this protein inhibits the initiation of DNA replication and cell cycle progression.

Poids moléculaire: 89 kDa (MW of target protein)

Pathways: Réparation de l'ADN, Mitotic G1-G1/S Phases, DNA Replication, Chromatin Binding, Synthesis of DNA