HERC5 anticorps (Middle Region)

N° du produit ABIN634098

Détail du produit anti-HERC5 anticorps

Antigène: HERC5 (Hect Domain and RLD 5 (HERC5))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp HERC5 est non-conjugé

Application: Western Blotting (WB)

Specificité: HERC5 antibody was raised against the middle region of HERC5

Purification: Affinity purified

Immunogène: HERC5 antibody was raised using the middle region of HERC5 corresponding to a region with amino acids FHPEELKDVIVGNTDYDWKTFEKNARYEPGYNSSHPTIVMFWKAFHKLTL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

HERC5 Blocking Peptide, catalog no. 33R-2921, is also available for use as a blocking control in assays to test for specificity of this HERC5 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HERC5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur HERC5

Antigène: HERC5 (Hect Domain and RLD 5 (HERC5))

Autre désignation: HERC5 (HERC5 Produits)

Synonymes: anticorps HERC5, anticorps CEB1, anticorps CEBP1, anticorps HECT and RLD domain containing E3 ubiquitin protein ligase 5, anticorps hect domain and RLD 5, anticorps HERC5

Sujet: This gene is a member of the HERC family of ubiquitin ligases and encodes a protein with a HECT domain and five RCC1 repeats. Pro-inflammatory cytokines upregulate expression of this gene in endothelial cells. The protein localizes to the cytoplasm and perinuclear region and functions as an interferon-induced E3 protein ligase that mediates ISGylation of protein targets. The gene lies in a cluster of HERC family genes on chromosome 4.

Poids moléculaire: 117 kDa (MW of target protein)