RFC3 anticorps
-
- Antigène Voir toutes RFC3 Anticorps
- RFC3 (Replication Factor C (Activator 1) 3, 38kDa (RFC3))
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp RFC3 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- RFC3 antibody was raised using a synthetic peptide corresponding to a region with amino acids IIMKGLLSELLHNCDGQLKGEVAQMAAYYEHRLQLGSKAIYHLEAFVAKF
- Top Product
- Discover our top product RFC3 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
RFC3 Blocking Peptide, catalog no. 33R-4003, is also available for use as a blocking control in assays to test for specificity of this RFC3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RFC3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- RFC3 (Replication Factor C (Activator 1) 3, 38kDa (RFC3))
- Autre désignation
- RFC3 (RFC3 Produits)
- Synonymes
- anticorps CG5313, anticorps DRFC, anticorps DmRFC3, anticorps Dmel\\CG5313, anticorps Rfc3, anticorps 21.m02902, anticorps 2810416I22Rik, anticorps 38kDa, anticorps AU022547, anticorps Recc3, anticorps cb275, anticorps RFC38, anticorps Replication factor C subunit 3, anticorps replication factor C3, anticorps replication factor C subunit 3, anticorps replication factor C 38 kDa subunit, anticorps DNA replication factor C complex subunit Rfc3, anticorps replication factor C3, putative, anticorps replication factor C (activator 1) 3, anticorps replication factor C subunit 3 L homeolog, anticorps RfC3, anticorps PF14_0601, anticorps Chro.30359, anticorps PB000006.01.0, anticorps PC000345.04.0, anticorps TP04_0380, anticorps Tb09.211.3310, anticorps PY04255, anticorps PVX_117300, anticorps BBOV_IV003080, anticorps SJAG_02182, anticorps PKH_124240, anticorps rfc3, anticorps Rfc3, anticorps RFC3, anticorps rfc3.L
- Sujet
- The elongation of primed DNA templates by DNA polymerase delta and DNA polymerase epsilon requires the accessory proteins proliferating cell nuclear antigen (PCNA) and replication factor C (RFC). RFC, also named activator 1, is a protein complex consisting of five distinct subunits of 140, 40, 38, 37, and 36 kDa. RFC3 is the 38 kDa subunit. This subunit is essential for the interaction between the 140 kDa subunit and the core complex that consists of the 36, 37, and 40 kDa subunits.
- Poids moléculaire
- 40 kDa (MW of target protein)
- Pathways
- Telomere Maintenance, Réparation de l'ADN, DNA Replication, Synthesis of DNA
-