REC8 anticorps

N° du produit ABIN634121

Détail du produit anti-REC8 anticorps

Antigène: REC8 (REC8 Homolog (Yeast) (REC8))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp REC8 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: Rec8 antibody was raised using a synthetic peptide corresponding to a region with amino acids QLQIGVIRVYSQQCQYLVEDIQHILERLHRAQLQIRIDMETELPSLLLPN

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Rec8 Blocking Peptide, catalog no. 33R-7641, is also available for use as a blocking control in assays to test for specificity of this Rec8 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of REC8 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur REC8

Antigène: REC8 (REC8 Homolog (Yeast) (REC8))

Autre désignation: Rec8 (REC8 Produits)

Synonymes: anticorps Rec8L1, anticorps mrec, anticorps HR21spB, anticorps REC8L1, anticorps Rec8p, anticorps REC8 meiotic recombination protein, anticorps REC8 homolog (yeast), anticorps REC8, anticorps Rec8

Sujet: REC8 is required during meiosis for separation of sister chromatids and homologous chromosomes. Proteolytic cleavage of REC8 on chromosome arms by separin during anaphase I allows for homologous chromosome separation in meiosis I and cleavage of REC8 on centromeres during anaphase II allows for sister chromatid separation in meiosis II.

Poids moléculaire: 62 kDa (MW of target protein)