ORC4 anticorps

N° du produit ABIN634162

Détail du produit anti-ORC4 anticorps

Antigène: ORC4 (Origin Recognition Complex, Subunit 4 (ORC4))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ORC4 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: ORC4 L antibody was raised using a synthetic peptide corresponding to a region with amino acids VLEICLIIAMKHLNDIYEEEPFNFQMVYNEFQKFVQRKAHSVYNFEKPVV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ORC4L Blocking Peptide, catalog no. 33R-9651, is also available for use as a blocking control in assays to test for specificity of this ORC4L antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ORC0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ORC4

Antigène: ORC4 (Origin Recognition Complex, Subunit 4 (ORC4))

Autre désignation: ORC4L (ORC4 Produits)

Synonymes: anticorps ORC4L, anticorps ORC4P, anticorps Orc4P, anticorps Orc4l, anticorps mMmORC4, anticorps CG2917, anticorps DmORC4, anticorps Dmel\\CG2917, anticorps ORC, anticorps ORC4, anticorps dmOrc4, anticorps orc4, anticorps rDmORC, anticorps orc4l, anticorps fc50c03, anticorps wu:fc50c03, anticorps zgc:85772, anticorps ATORC4, anticorps F23H14.9, anticorps F23H14_9, anticorps ORIGIN RECOGNITION COMPLEX SUBUNIT 4, anticorps origin recognition complex subunit 4, anticorps origin recognition complex subunit 4, anticorps origin recognition complex, subunit 4, anticorps Origin recognition complex subunit 4, anticorps origin recognition complex subunit 4 L homeolog, anticorps origin recognition complex subunit Orc4, anticorps ORC4, anticorps Orc4, anticorps orc4.L, anticorps orc4, anticorps CNM01830

Sujet: The origin recognition complex (ORC) is a highly conserved six subunit protein complex essential for the initiation of the DNA replication in eukaryotic cells.

Poids moléculaire: 50 kDa (MW of target protein)

Pathways: Mitotic G1-G1/S Phases, DNA Replication, Synthesis of DNA