BTG4 anticorps (Middle Region)

N° du produit ABIN634168

Détail du produit anti-BTG4 anticorps

Antigène: BTG4 (B-Cell Translocation Gene 4 (BTG4))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp BTG4 est non-conjugé

Application: Western Blotting (WB)

Specificité: BTG4 antibody was raised against the middle region of BTG4

Purification: Affinity purified

Immunogène: BTG4 antibody was raised using the middle region of BTG4 corresponding to a region with amino acids ILERACVESNVDFSHLGLPKEMTIWVDPFEVCCRYGEKNHPFTVASFKGR

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

BTG4 Blocking Peptide, catalog no. 33R-4043, is also available for use as a blocking control in assays to test for specificity of this BTG4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BTG4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur BTG4

Antigène: BTG4 (B-Cell Translocation Gene 4 (BTG4))

Autre désignation: BTG4 (BTG4 Produits)

Synonymes: anticorps SCIR-27, anticorps b9-a, anticorps pc3b, anticorps C86116, anticorps PC3B, anticorps BTG anti-proliferation factor 4, anticorps BTG family member 4 L homeolog, anticorps B cell translocation gene 4, anticorps Btg4, anticorps btg4.L, anticorps BTG4

Sujet: The protein encoded by this gene is a member of the BTG/Tob family. This family has structurally related proteins that appear to have antiproliferative properties. This encoded protein can induce G1 arrest in the cell cycle.

Poids moléculaire: 26 kDa (MW of target protein)