BUB3 anticorps

N° du produit ABIN634196

Détail du produit anti-BUB3 anticorps

Antigène: BUB3 (Budding Uninhibited By Benzimidazoles 3 Homolog (Yeast) (BUB3))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp BUB3 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: BUB3 antibody was raised using a synthetic peptide corresponding to a region with amino acids MTGSNEFKLNQPPEDGISSVKFSPNTSQFLLVSSWDTSVRLYDVPANSMR

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

BUB3 Blocking Peptide, catalog no. 33R-6544, is also available for use as a blocking control in assays to test for specificity of this BUB3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BUB3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur BUB3

Antigène: BUB3 (Budding Uninhibited By Benzimidazoles 3 Homolog (Yeast) (BUB3))

Autre désignation: BUB3 (BUB3 Produits)

Synonymes: anticorps BUB3L, anticorps hBUB3, anticorps Aa2-050, anticorps xbub3, anticorps AU019800, anticorps AU021329, anticorps AU043350, anticorps AW146323, anticorps C78067, anticorps BUB3, mitotic checkpoint protein, anticorps BUB3 mitotic checkpoint protein, anticorps BUB3 mitotic checkpoint protein L homeolog, anticorps BUB3, anticorps Bub3, anticorps bub3.L

Sujet: BUB3 is required for kinetochore localization of BUB1.

Poids moléculaire: 36 kDa (MW of target protein)

Pathways: Maintenance of Protein Location