PARD3 anticorps
-
- Antigène Voir toutes PARD3 Anticorps
- PARD3 (Par-3 Partitioning Defective 3 Homolog (PARD3))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp PARD3 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- PARD3 antibody was raised using a synthetic peptide corresponding to a region with amino acids EQQMKKQPPSEGPSNYDSYKKVQDPSYAPPKGPFRQDVPPSPSQVARLNR
- Top Product
- Discover our top product PARD3 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
PARD3 Blocking Peptide, catalog no. 33R-2675, is also available for use as a blocking control in assays to test for specificity of this PARD3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PARD3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- PARD3 (Par-3 Partitioning Defective 3 Homolog (PARD3))
- Autre désignation
- PARD3 (PARD3 Produits)
- Synonymes
- anticorps ASIP, anticorps Baz, anticorps PAR3, anticorps PAR3alpha, anticorps PARD-3, anticorps PARD3A, anticorps SE2-5L16, anticorps SE2-5LT1, anticorps SE2-5T2, anticorps Par3, anticorps AA960621, anticorps AI256638, anticorps D8Ertd580e, anticorps PAR-3, anticorps Pard3a, anticorps asip, anticorps bazooka, anticorps par-3, anticorps par3, anticorps pard3, anticorps par-3 family cell polarity regulator, anticorps partitioning defective 3 homolog, anticorps par-3 family cell polarity regulator alpha, b, anticorps par-3 family cell polarity regulator S homeolog, anticorps PARD3, anticorps Pard3, anticorps LOC100551156, anticorps LOC100473914, anticorps pard3, anticorps pard3ab, anticorps pard3.S
- Sujet
- PARD proteins, which were first identified in C. elegans, are essential for asymmetric cell division and polarized growth, whereas CDC42 mediates the establishment of cell polarity. The CDC42 GTPase, which is controlled by nucleotide exchange.
- Poids moléculaire
- 151 kDa (MW of target protein)
- Pathways
- Cell-Cell Junction Organization
-