SLC12A4 anticorps
-
- Antigène Voir toutes SLC12A4 Anticorps
- SLC12A4 (Solute Carrier Family 12 (Potassium-Chloride Transporter) Member 4 (SLC12A4))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp SLC12A4 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- SLC12 A4 antibody was raised using a synthetic peptide corresponding to a region with amino acids MPHFTVVPVDGPRRGDYDNLEGLSWVDYGERAELDDSDGHGNHRESSPFL
- Top Product
- Discover our top product SLC12A4 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
SLC12A4 Blocking Peptide, catalog no. 33R-6285, is also available for use as a blocking control in assays to test for specificity of this SLC12A4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC10 4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- SLC12A4 (Solute Carrier Family 12 (Potassium-Chloride Transporter) Member 4 (SLC12A4))
- Autre désignation
- SLC12A4 (SLC12A4 Produits)
- Synonymes
- anticorps KCC1, anticorps kcc1, anticorps SLC12A4, anticorps AW546649, anticorps RBCKCC1, anticorps Kcc1, anticorps solute carrier family 12 member 4, anticorps solute carrier family 12 (potassium/chloride transporter), member 4 L homeolog, anticorps solute carrier family 12, member 4, anticorps SLC12A4, anticorps slc12a4.L, anticorps Slc12a4
- Sujet
- SLC12A4 mediates electroneutral potassium-chloride cotransport when activated by cell swelling. SLC12A4 may contribute to cell volume homeostasis in single cells.
- Poids moléculaire
- 121 kDa (MW of target protein)
-