GNAI2 anticorps
-
- Antigène Voir toutes GNAI2 Anticorps
- GNAI2 (Guanine Nucleotide Binding Protein (G Protein), alpha Inhibiting Activity Polypeptide 2 (GNAI2))
-
Reactivité
- Humain, Souris, Rat, Chien
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp GNAI2 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- GNAI2 antibody was raised using a synthetic peptide corresponding to a region with amino acids EYQLNDSAAYYLNDLERIAQSDYIPTQQDVLRTRVKTTGIVETHFTFKDL
- Top Product
- Discover our top product GNAI2 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
GNAI2 Blocking Peptide, catalog no. 33R-2827, is also available for use as a blocking control in assays to test for specificity of this GNAI2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GNAI2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- GNAI2 (Guanine Nucleotide Binding Protein (G Protein), alpha Inhibiting Activity Polypeptide 2 (GNAI2))
- Autre désignation
- GNAI2 (GNAI2 Produits)
- Synonymes
- anticorps Galphai2, anticorps C76432, anticorps Gia, anticorps Gnai-2, anticorps fi21e06, anticorps gnai2, anticorps wu:fi21e06, anticorps zgc:56690, anticorps gip, anticorps gnai2b, anticorps gnai3, anticorps GIP, anticorps GNAI2B, anticorps H_LUCA15.1, anticorps H_LUCA16.1, anticorps GBI2, anticorps gi2alpha, anticorps Gnai2, anticorps gnai2l, anticorps wu:fb10b04, anticorps wu:fb19c04, anticorps zgc:92609, anticorps G protein subunit alpha i2, anticorps guanine nucleotide binding protein (G protein), alpha inhibiting 2, anticorps guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 2b, anticorps guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 2 S homeolog, anticorps guanine nucleotide-binding protein G(i) subunit alpha 2, anticorps guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 2a, anticorps Gnai2, anticorps gnai2b, anticorps gnai2.S, anticorps GNAI2, anticorps gnai2, anticorps gnai2a
- Sujet
- Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems. The G(i) proteins are involved in hormonal regulation of adenylate cyclase: they inhibit the cyclase in response to beta-adrenergic stimuli.
- Poids moléculaire
- 40 kDa (MW of target protein)
- Pathways
- cAMP Metabolic Process, G-protein mediated Events, Thromboxane A2 Receptor Signaling
-