C4BPA anticorps (Middle Region)

N° du produit ABIN634312

Détail du produit anti-C4BPA anticorps

Antigène: C4BPA (Complement Component 4 Binding Protein, alpha (C4BPA))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp C4BPA est non-conjugé

Application: Western Blotting (WB)

Specificité: C4 BPA antibody was raised against the middle region of C4 PA

Purification: Affinity purified

Immunogène: C4 BPA antibody was raised using the middle region of C4 PA corresponding to a region with amino acids QVLTGKRLMQCLPNPEDVKMALEVYKLSLEIEQLELQRDSARQSTLDKEL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

C4BPA Blocking Peptide, catalog no. 33R-7781, is also available for use as a blocking control in assays to test for specificity of this C4BPA antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 PA antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur C4BPA

Antigène: C4BPA (Complement Component 4 Binding Protein, alpha (C4BPA))

Autre désignation: C4BPA (C4BPA Produits)

Synonymes: anticorps CRES, anticorps c4bp, anticorps C4BP, anticorps PRP, anticorps complement component 4 binding protein, alpha chain, anticorps C4b-binding protein alpha chain, anticorps complement component 4 binding protein alpha, anticorps complement component 4 binding protein, alpha, anticorps LOC419851, anticorps c4bp, anticorps C4BPA, anticorps C4bpa

Sujet: C4BPA is a member of a superfamily of proteins composed predominantly of tandemly arrayed short consensus repeats of approximately 60 amino acids. Along with a single, unique beta-chain, seven identical alpha-chains encoded by this gene assemble into the predominant isoform of C4b-binding protein, a multimeric protein that controls activation of the complement cascade through the classical pathway. The genes encoding both alpha and beta chains are located adjacent to each other on human chromosome 1 in the regulator of complement activation gene cluster.

Poids moléculaire: 62 kDa (MW of target protein)

Pathways: Système du Complément