C4B anticorps

N° du produit ABIN634315

Détail du produit anti-C4B anticorps

Antigène: C4B (C4b) (Complement Component C4b (C4b))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp C4B est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: Complement C4 b antibody was raised using a synthetic peptide corresponding to a region with amino acids QTDQPIYNPGQRVRYRVFALDQKMRPSTDTITVMVENSHGLRVRKKEVYM

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Complement C4b Blocking Peptide, catalog no. 33R-7746, is also available for use as a blocking control in assays to test for specificity of this Complement C4b antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur C4B

Antigène: C4B (C4b) (Complement Component C4b (C4b))

Autre désignation: Complement C4b (C4b Produits)

Synonymes: anticorps C4B1, anticorps C4B12, anticorps C4B2, anticorps C4B3, anticorps C4B5, anticorps C4BD, anticorps C4B_2, anticorps C4F, anticorps CH, anticorps CO4, anticorps CPAMD3, anticorps C4, anticorps C4A2, anticorps C4A3, anticorps C4A4, anticorps C4A6, anticorps C4AD, anticorps C4S, anticorps CPAMD2, anticorps RG, anticorps wu:fi14a03, anticorps C4B, anticorps DKFZP469I0332, anticorps Slp, anticorps Ss, anticorps C4-2, anticorps C4l, anticorps complement C4B (Chido blood group), anticorps complement C4A (Rodgers blood group), anticorps complement component 4, anticorps complement C4-B, anticorps complement component 4B (Chido blood group), anticorps complement component 4A (Rodgers blood group), anticorps C4B, anticorps C4A, anticorps c4, anticorps LOC462577, anticorps C4a, anticorps C4b

Sujet: C4B is the basic form of complement factor 4, part of the classical activation pathway. The protein is expressed as a single chain precursor which is proteolytically cleaved into a trimer of alpha, beta, and gamma chains prior to secretion. The trimer provides a surface for interaction between the antigen-antibody complex and other complement components. The alpha chain may be cleaved to release C4 anaphylatoxin, a mediator of local inflammation. Deficiency of this protein is associated with systemic lupus erythematosus. This gene encodes the basic form of complement factor 4, part of the classical activation pathway.

Poids moléculaire: 33 kDa (MW of target protein)

Pathways: Système du Complément