MAP3K2 anticorps (N-Term)
-
- Antigène Voir toutes MAP3K2 Anticorps
- MAP3K2 (Mitogen-Activated Protein Kinase Kinase Kinase 2 (MAP3K2))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp MAP3K2 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- MAP3 K2 antibody was raised against the N terminal of MAP3 2
- Purification
- Affinity purified
- Immunogène
- MAP3 K2 antibody was raised using the N terminal of MAP3 2 corresponding to a region with amino acids AERKKRLSIIGPTSRDRSSPPPGYIPDELHQVARNGSFTSINSEGEFIPE
- Top Product
- Discover our top product MAP3K2 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
MAP3K2 Blocking Peptide, catalog no. 33R-1147, is also available for use as a blocking control in assays to test for specificity of this MAP3K2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MAP0 2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- MAP3K2 (Mitogen-Activated Protein Kinase Kinase Kinase 2 (MAP3K2))
- Autre désignation
- MAP3K2 (MAP3K2 Produits)
- Synonymes
- anticorps Mekk2, anticorps MEKK2, anticorps MEKK2B, anticorps 9630061B06Rik, anticorps AI585793, anticorps Mekk2b, anticorps mitogen activated protein kinase kinase kinase 2, anticorps mitogen-activated protein kinase kinase kinase 2, anticorps Map3k2, anticorps MAP3K2
- Sujet
- MAP3K2 is a component of a protein kinase signal transduction cascade. It regulates the JNK and ERK5 pathways by phosphorylating and activating MAP2K5 and MAP2K7. It also plays a role in caveolae kiss-and-run dynamics.
- Poids moléculaire
- 70 kDa (MW of target protein)
- Pathways
- Signalisation MAPK
-