TAB1 anticorps (N-Term)

N° du produit ABIN634348

Détail du produit anti-TAB1 anticorps

Antigène: TAB1 (TGF-beta Activated Kinase 1/MAP3K7 Binding Protein 1 (TAB1))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TAB1 est non-conjugé

Application: Western Blotting (WB)

Specificité: MAP3 K3 P1 antibody was raised against the N terminal of MAP3 3 P1

Purification: Affinity purified

Immunogène: MAP3 K3 P1 antibody was raised using the N terminal of MAP3 3 P1 corresponding to a region with amino acids MAAQRRSLLQSEQQPSWTDDLPLCHLSGVGSASNRSYSADGKGTESHPPE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MAP3K7IP1 Blocking Peptide, catalog no. 33R-5608, is also available for use as a blocking control in assays to test for specificity of this MAP3K7IP1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MAP0 0 P1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TAB1

Antigène: TAB1 (TGF-beta Activated Kinase 1/MAP3K7 Binding Protein 1 (TAB1))

Autre désignation: MAP3K7IP1 (TAB1 Produits)

Synonymes: anticorps 3'-Tab1, anticorps MAP3K7IP1, anticorps 2310012M03Rik, anticorps Map3k7ip1, anticorps b2b449Clo, anticorps TGF-beta activated kinase 1 (MAP3K7) binding protein 1, anticorps TGF-beta activated kinase 1/MAP3K7 binding protein 1, anticorps TAB1, anticorps Tab1

Sujet: The protein encoded by this gene was identified as a regulator of the MAP kinase MAP3K7/TAK1, which is known to mediate various intracellular signaling pathways, such as those induced by TGF beta, interleukin 1, and WNT-1.

Poids moléculaire: 50 kDa (MW of target protein)

Pathways: Signalisation TLR, Fc-epsilon Receptor Signaling Pathway, Activation of Innate immune Response, Toll-Like Receptors Cascades