MAP4K5 anticorps (Middle Region)

N° du produit ABIN634353

Détail du produit anti-MAP4K5 anticorps

Antigène: MAP4K5 (Mitogen-Activated Protein Kinase Kinase Kinase Kinase 5 (MAP4K5))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MAP4K5 est non-conjugé

Application: Western Blotting (WB)

Specificité: MAP4 K5 antibody was raised against the middle region of MAP4 5

Purification: Affinity purified

Immunogène: MAP4 K5 antibody was raised using the middle region of MAP4 5 corresponding to a region with amino acids QGKSFKSDEVTQEISDETRVFRLLGSDRVVVLESRPTENPTAHSNLYILA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MAP4K5 Blocking Peptide, catalog no. 33R-7562, is also available for use as a blocking control in assays to test for specificity of this MAP4K5 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MAP0 5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MAP4K5

Antigène: MAP4K5 (Mitogen-Activated Protein Kinase Kinase Kinase Kinase 5 (MAP4K5))

Autre désignation: MAP4K5 (MAP4K5 Produits)

Synonymes: anticorps GCKR, anticorps KHS, anticorps KHS1, anticorps MAPKKKK5, anticorps 4432415E19Rik, anticorps RGD1562028, anticorps fl74c10, anticorps wu:fl74c10, anticorps zgc:55719, anticorps zgc:55985, anticorps mitogen-activated protein kinase kinase kinase kinase 5, anticorps mitogen-activated protein kinase kinase kinase kinase 5 S homeolog, anticorps MAP4K5, anticorps Map4k5, anticorps map4k5, anticorps map4k5.S

Sujet: MAP4K5 may play a role in the response to environmental stress. Appears to act upstream of the JUN N-terminal pathway.

Poids moléculaire: 95 kDa (MW of target protein)