PTK6 anticorps (Middle Region)
-
- Antigène Voir toutes PTK6 Anticorps
- PTK6 (PTK6 Protein tyrosine Kinase 6 (PTK6))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp PTK6 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- PTK6 antibody was raised against the middle region of PTK6
- Purification
- Affinity purified
- Immunogène
- PTK6 antibody was raised using the middle region of PTK6 corresponding to a region with amino acids SELLDIAWQVAEGMCYLESQNYIHRDLAARNILVGENTLCKVGDFGLARL
- Top Product
- Discover our top product PTK6 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
PTK6 Blocking Peptide, catalog no. 33R-8390, is also available for use as a blocking control in assays to test for specificity of this PTK6 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PTK6 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- PTK6 (PTK6 Protein tyrosine Kinase 6 (PTK6))
- Autre désignation
- PTK6 (PTK6 Produits)
- Synonymes
- anticorps BRK, anticorps Sik, anticorps Tksk, anticorps tks, anticorps zgc:153964, anticorps protein tyrosine kinase 6, anticorps PTK6 protein tyrosine kinase 6, anticorps PTK6 protein tyrosine kinase 6b, anticorps PTK6, anticorps Ptk6, anticorps ptk6b
- Sujet
- The protein encoded by this gene is a cytoplasmic nonreceptor protein kinase which may function as an intracellular signal transducer in epithelial tissues.
- Poids moléculaire
- 52 kDa (MW of target protein)
-