PTK6 anticorps (Middle Region)

N° du produit ABIN634359

Détail du produit anti-PTK6 anticorps

Antigène: PTK6 (PTK6 Protein tyrosine Kinase 6 (PTK6))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PTK6 est non-conjugé

Application: Western Blotting (WB)

Specificité: PTK6 antibody was raised against the middle region of PTK6

Purification: Affinity purified

Immunogène: PTK6 antibody was raised using the middle region of PTK6 corresponding to a region with amino acids SELLDIAWQVAEGMCYLESQNYIHRDLAARNILVGENTLCKVGDFGLARL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PTK6 Blocking Peptide, catalog no. 33R-8390, is also available for use as a blocking control in assays to test for specificity of this PTK6 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PTK6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PTK6

Antigène: PTK6 (PTK6 Protein tyrosine Kinase 6 (PTK6))

Autre désignation: PTK6 (PTK6 Produits)

Synonymes: anticorps BRK, anticorps Sik, anticorps Tksk, anticorps tks, anticorps zgc:153964, anticorps protein tyrosine kinase 6, anticorps PTK6 protein tyrosine kinase 6, anticorps PTK6 protein tyrosine kinase 6b, anticorps PTK6, anticorps Ptk6, anticorps ptk6b

Sujet: The protein encoded by this gene is a cytoplasmic nonreceptor protein kinase which may function as an intracellular signal transducer in epithelial tissues.

Poids moléculaire: 52 kDa (MW of target protein)