Sorting Nexin 7 anticorps (Middle Region)

N° du produit ABIN634368

Détail du produit anti-Sorting Nexin 7 anticorps

Antigène: Sorting Nexin 7 (SNX7)

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Sorting Nexin 7 est non-conjugé

Application: Western Blotting (WB)

Specificité: SNX7 antibody was raised against the middle region of SNX7

Purification: Affinity purified

Immunogène: SNX7 antibody was raised using the middle region of SNX7 corresponding to a region with amino acids LDSKVEVLTYKKADTDLLPEEIGKLEDKVECANNALKADWERWKQNMQND

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SNX7 Blocking Peptide, catalog no. 33R-4867, is also available for use as a blocking control in assays to test for specificity of this SNX7 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SNX7 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Sorting Nexin 7

Antigène: Sorting Nexin 7 (SNX7)

Autre désignation: SNX7 (SNX7 Produits)

Synonymes: anticorps zgc:92458, anticorps SNX7, anticorps 2510028H01Rik, anticorps sorting nexin 7, anticorps sorting nexin-7, anticorps SNX7, anticorps snx7, anticorps LOC715581, anticorps LOC716015, anticorps Snx7

Sujet: This gene encodes a member of the sorting nexin family. Members of this family contain a phox (PX) domain, which is a phosphoinositide binding domain, and are involved in intracellular trafficking.

Poids moléculaire: 45 kDa (MW of target protein)