CD160 anticorps (Middle Region)
-
- Antigène Voir toutes CD160 Anticorps
- CD160
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp CD160 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- CD160 antibody was raised against the middle region of CD160
- Purification
- Affinity purified
- Immunogène
- CD160 antibody was raised using the middle region of CD160 corresponding to a region with amino acids SGTYQCCARSQKSGIRLQGHFFSILFTETGNYTVTGLKQRQHLEFSHNEG
- Top Product
- Discover our top product CD160 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
CD160 Blocking Peptide, catalog no. 33R-8498, is also available for use as a blocking control in assays to test for specificity of this CD160 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CD160 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- CD160
- Autre désignation
- CD160 (CD160 Produits)
- Synonymes
- anticorps CD160, anticorps RGD1563598, anticorps BY55, anticorps AU045688, anticorps By55, anticorps NK1, anticorps NK28, anticorps CD160 molecule, anticorps CD160 antigen, anticorps CD160, anticorps Cd160
- Sujet
- CD160 is an 27 kDa glycoprotein which was initially identified with the monoclonal antibody BY55. Its expression is tightly associated with peripheral blood NK cells and CD8 T lymphocytes with cytolytic effector activity.
- Poids moléculaire
- 20 kDa (MW of target protein)
-