RGS11 anticorps (Middle Region)

N° du produit ABIN634383

Détail du produit anti-RGS11 anticorps

Antigène: RGS11 (Regulator of G-Protein Signaling 11 (RGS11))

Épitope: Middle Region

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RGS11 est non-conjugé

Application: Western Blotting (WB)

Specificité: RGS11 antibody was raised against the middle region of RGS11

Purification: Affinity purified

Immunogène: RGS11 antibody was raised using the middle region of RGS11 corresponding to a region with amino acids LRQPHRYVLDDAQLHIYMLMKKDSYPRFLKSDMYKALLAEAGIPLEMKRR

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RGS11 Blocking Peptide, catalog no. 33R-5382, is also available for use as a blocking control in assays to test for specificity of this RGS11 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RGS11 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RGS11

Antigène: RGS11 (Regulator of G-Protein Signaling 11 (RGS11))

Autre désignation: RGS11 (RGS11 Produits)

Synonymes: anticorps RS11, anticorps C78048, anticorps XRGSIV, anticorps rgs9-a, anticorps regulator of G protein signaling 11, anticorps regulator of G-protein signaling 11, anticorps regulator of G-protein signaling 11 L homeolog, anticorps RGS11, anticorps Rgs11, anticorps rgs11.L

Sujet: RGS11 belongs to the RGS (regulator of G protein signaling) family. Members of the RGS family act as GTPase-activating proteins on the alpha subunits of heterotrimeric, signal-transducing G proteins. This protein inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits, thereby driving them into their inactive GDP-bound form.

Poids moléculaire: 51 kDa (MW of target protein)

Pathways: Myometrial Relaxation and Contraction, Regulation of G-Protein Coupled Receptor Protein Signaling