GLMN anticorps (Middle Region)
-
- Antigène Voir toutes GLMN Anticorps
- GLMN (Glomulin, FKBP Associated Protein (GLMN))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp GLMN est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- GLMN antibody was raised against the middle region of GLMN
- Purification
- Affinity purified
- Immunogène
- GLMN antibody was raised using the middle region of GLMN corresponding to a region with amino acids LKRTRNNKWFTGPQLISLLDLVLFLPEGAETDLLQNSDRIMASLNLLRYL
- Top Product
- Discover our top product GLMN Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
GLMN Blocking Peptide, catalog no. 33R-5102, is also available for use as a blocking control in assays to test for specificity of this GLMN antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GLMN antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- GLMN (Glomulin, FKBP Associated Protein (GLMN))
- Autre désignation
- GLMN (GLMN Produits)
- Synonymes
- anticorps FAP, anticorps FAP48, anticorps FAP68, anticorps FKBPAP, anticorps GLML, anticorps GVM, anticorps VMGLOM, anticorps 9330160J16Rik, anticorps AW227515, anticorps Fap48, anticorps Fap68, anticorps MGC69174, anticorps GLMN, anticorps zgc:194957, anticorps glmnl, anticorps zgc:101567, anticorps glomulin, FKBP associated protein, anticorps glomulin, FKBP associated protein L homeolog, anticorps glomulin, FKBP associated protein b, anticorps glomulin, FKBP associated protein a, anticorps GLMN, anticorps Glmn, anticorps glmn.L, anticorps glmn, anticorps glmnb, anticorps glmna
- Sujet
- GLMN is a phosphorylated protein that is a member of a Skp1-Cullin-F-box-like complex. The protein is essential for normal development of the vasculature and mutations in this gene have been associated with glomuvenous malformations, also called glomangiomas. Alternatively spliced variants that encode different protein isoforms have been described but the full-length nature of only one has been determined.
- Poids moléculaire
- 68 kDa (MW of target protein)
- Pathways
- Tube Formation
-