GLMN anticorps (Middle Region)

N° du produit ABIN634391

Détail du produit anti-GLMN anticorps

Antigène: GLMN (Glomulin, FKBP Associated Protein (GLMN))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GLMN est non-conjugé

Application: Western Blotting (WB)

Specificité: GLMN antibody was raised against the middle region of GLMN

Purification: Affinity purified

Immunogène: GLMN antibody was raised using the middle region of GLMN corresponding to a region with amino acids LKRTRNNKWFTGPQLISLLDLVLFLPEGAETDLLQNSDRIMASLNLLRYL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GLMN Blocking Peptide, catalog no. 33R-5102, is also available for use as a blocking control in assays to test for specificity of this GLMN antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GLMN antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur GLMN

Antigène: GLMN (Glomulin, FKBP Associated Protein (GLMN))

Autre désignation: GLMN (GLMN Produits)

Synonymes: anticorps FAP, anticorps FAP48, anticorps FAP68, anticorps FKBPAP, anticorps GLML, anticorps GVM, anticorps VMGLOM, anticorps 9330160J16Rik, anticorps AW227515, anticorps Fap48, anticorps Fap68, anticorps MGC69174, anticorps GLMN, anticorps zgc:194957, anticorps glmnl, anticorps zgc:101567, anticorps glomulin, FKBP associated protein, anticorps glomulin, FKBP associated protein L homeolog, anticorps glomulin, FKBP associated protein b, anticorps glomulin, FKBP associated protein a, anticorps GLMN, anticorps Glmn, anticorps glmn.L, anticorps glmn, anticorps glmnb, anticorps glmna

Sujet: GLMN is a phosphorylated protein that is a member of a Skp1-Cullin-F-box-like complex. The protein is essential for normal development of the vasculature and mutations in this gene have been associated with glomuvenous malformations, also called glomangiomas. Alternatively spliced variants that encode different protein isoforms have been described but the full-length nature of only one has been determined.

Poids moléculaire: 68 kDa (MW of target protein)

Pathways: Tube Formation