MKNK2 anticorps (N-Term)

N° du produit ABIN634405

Détail du produit anti-MKNK2 anticorps

Antigène: MKNK2 (MAP Kinase Interacting serine/threonine Kinase 2 (MKNK2))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MKNK2 est non-conjugé

Application: Western Blotting (WB)

Specificité: MKNK2 antibody was raised against the N terminal of MKNK2

Purification: Affinity purified

Immunogène: MKNK2 antibody was raised using the N terminal of MKNK2 corresponding to a region with amino acids SDFGLQCSARPDMPASQPIDIPDAKKRGKKKKRGRATDSFSGRFEDVYQL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MKNK2 Blocking Peptide, catalog no. 33R-8351, is also available for use as a blocking control in assays to test for specificity of this MKNK2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MKNK2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MKNK2

Antigène: MKNK2 (MAP Kinase Interacting serine/threonine Kinase 2 (MKNK2))

Autre désignation: MKNK2 (MKNK2 Produits)

Synonymes: anticorps GPRK7, anticorps MNK2, anticorps gprk7, anticorps mnk2, anticorps 2010016G11Rik, anticorps Gprk7, anticorps Mnk2, anticorps mknk2, anticorps wu:fb37e05, anticorps wz5090, anticorps fi34c11, anticorps wu:fi34c11, anticorps wu:fi41e12, anticorps zgc:55587, anticorps MAP kinase interacting serine/threonine kinase 2, anticorps MAP kinase-interacting serine/threonine kinase 2, anticorps MAP kinase interacting serine/threonine kinase 2b, anticorps MAP kinase interacting serine/threonine kinase 2 L homeolog, anticorps MAP kinase interacting serine/threonine kinase 2a, anticorps MKNK2, anticorps mknk2, anticorps Mknk2, anticorps mknk2b, anticorps mknk2.L, anticorps mknk2a

Sujet: MKNK2 may play a role in the response to environmental stress and cytokines. It appears to regulate transcription by phosphorylating EIF4E, thus increasing the affinity of this protein for the 7-methylguanosine-containing mRNA cap.

Poids moléculaire: 51 kDa (MW of target protein)

Pathways: Signalisation MAPK