ACOT11 anticorps (Middle Region)
-
- Antigène Voir toutes ACOT11 Anticorps
- ACOT11 (Acyl-CoA Thioesterase 11 (ACOT11))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp ACOT11 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- ACOT11 antibody was raised against the middle region of ACOT11
- Purification
- Affinity purified
- Immunogène
- ACOT11 antibody was raised using the middle region of ACOT11 corresponding to a region with amino acids AEKTRVESVELVLPPHANHQGNTFGGQIMAWMENVATIAASRLCRAHPTL
- Top Product
- Discover our top product ACOT11 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
ACOT11 Blocking Peptide, catalog no. 33R-1133, is also available for use as a blocking control in assays to test for specificity of this ACOT11 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACOT11 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- ACOT11 (Acyl-CoA Thioesterase 11 (ACOT11))
- Autre désignation
- ACOT11 (ACOT11 Produits)
- Synonymes
- anticorps BFIT, anticorps STARD14, anticorps THEA, anticorps THEM1, anticorps 1110020M10Rik, anticorps 2010309H15Rik, anticorps AW060409, anticorps BFIT1, anticorps Thea, anticorps Them1, anticorps mKIAA0707, anticorps acot11, anticorps zgc:113011, anticorps ACOT11, anticorps DKFZp469E1816, anticorps acyl-CoA thioesterase 11, anticorps acyl-CoA thioesterase 11a, anticorps acyl-CoA thioesterase 11 L homeolog, anticorps ACOT11, anticorps Acot11, anticorps acot11a, anticorps acot11.L, anticorps acot11
- Sujet
- ACOT11 is a protein with acyl-CoA thioesterase activity towards medium (C12) and long-chain (C18) fatty acyl-CoA substrates. Expression of a similar murine protein in brown adipose tissue is induced by cold exposure and repressed by warmth.
- Poids moléculaire
- 65 kDa (MW of target protein)
-