DIRAS1 anticorps (Middle Region)
-
- Antigène Voir toutes DIRAS1 Anticorps
- DIRAS1 (DIRAS Family, GTP-Binding RAS-Like 1 (DIRAS1))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp DIRAS1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- DIRAS1 antibody was raised against the middle region of DIRAS1
- Purification
- Affinity purified
- Immunogène
- DIRAS1 antibody was raised using the middle region of DIRAS1 corresponding to a region with amino acids KCAFMETSAKMNYNVKELFQELLTLETRRNMSLNIDGKRSGKQKRTDRVK
- Top Product
- Discover our top product DIRAS1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
DIRAS1 Blocking Peptide, catalog no. 33R-4266, is also available for use as a blocking control in assays to test for specificity of this DIRAS1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DIRAS1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- DIRAS1 (DIRAS Family, GTP-Binding RAS-Like 1 (DIRAS1))
- Autre désignation
- DIRAS1 (DIRAS1 Produits)
- Synonymes
- anticorps Di-Ras1, anticorps GBTS1, anticorps RIG, anticorps Gbts1, anticorps diras1, anticorps fi18d11, anticorps wu:fi18d11, anticorps zgc:55360, anticorps si:dkey-97k23.2, anticorps rig, anticorps gbts1, anticorps di-ras1, anticorps MGC146486, anticorps DIRAS family GTPase 1, anticorps DIRAS family, GTP-binding RAS-like 1, anticorps DIRAS family, GTP-binding RAS-like 1a, anticorps DIRAS family, GTP-binding RAS-like 1b, anticorps DIRAS family GTP binding RAS like 1, anticorps DIRAS1, anticorps Diras1, anticorps diras1a, anticorps diras1b, anticorps diras1
- Sujet
- DIRAS1 belongs to a distinct branch of the functionally diverse Ras superfamily of monomeric GTPases.
- Poids moléculaire
- 22 kDa (MW of target protein)
- Pathways
- Ribonucleoprotein Complex Subunit Organization, Ribosome Assembly
-