ARF1 anticorps (Middle Region)

N° du produit ABIN634449

Détail du produit anti-ARF1 anticorps

Antigène: ARF1 (ADP-Ribosylation Factor 1 (ARF1))

Épitope: Middle Region

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ARF1 est non-conjugé

Application: Western Blotting (WB)

Specificité: ARF1 antibody was raised against the middle region of ARF1

Purification: Affinity purified

Immunogène: ARF1 antibody was raised using the middle region of ARF1 corresponding to a region with amino acids MRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ARF1 Blocking Peptide, catalog no. 33R-6371, is also available for use as a blocking control in assays to test for specificity of this ARF1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ARF1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ARF1

Antigène: ARF1 (ADP-Ribosylation Factor 1 (ARF1))

Autre désignation: ARF1 (ARF1 Produits)

Synonymes: anticorps wu:fb33e02, anticorps wu:fb78h01, anticorps arf2, anticorps arf-1, anticorps MGC52573, anticorps ADP-RIBOSYLATION FACTOR, anticorps ADP-RIBOSYLATION FACTOR 1A, anticorps ADP-ribosylation factor 1, anticorps ATARF, anticorps ATARF1, anticorps ATARFA1A, anticorps F28C11.12, anticorps ARF1, anticorps arf1, anticorps ADP ribosylation factor 1, anticorps ADP-ribosylation factor 1, anticorps ADP ribosylation factor 1 L homeolog, anticorps ADP ribosylation factor 5 L homeolog, anticorps ADP ribosylation factor 1 pseudogene, anticorps adp-ribosylation factor 1, anticorps ARF1, anticorps Arf1, anticorps arf1, anticorps arf1.L, anticorps arf5.L, anticorps NCU08340, anticorps TRIADDRAFT_63238, anticorps PAAG_08805, anticorps LOC100280562, anticorps LOC100280918, anticorps LOC474591, anticorps CLUG_01013

Sujet: ADP-ribosylation factor 1 (ARF1) is a member of the human ARF family. The family is composed of small guanine nucleotide-binding proteins that stimulate the ADP-ribosyltransferase activity of cholera toxin and play a role in vesicular trafficking as activators of phospholipase D. These protein, including 6 ARF proteins and 11 ARF-like proteins, constitute a family of the RAS superfamily. The ARF proteins are categorized as class I (ARF1, ARF2 and ARF3), class II (ARF4 and ARF5) and class III (ARF6), and members of each class share a common gene organization.

Poids moléculaire: 21 kDa (MW of target protein)

Pathways: Transition Metal Ion Homeostasis, Inositol Metabolic Process