OAS1 anticorps (C-Term)

N° du produit ABIN634457

Détail du produit anti-OAS1 anticorps

Antigène: OAS1 (2',5'-Oligoadenylate Synthetase 1, 40/46kDa (OAS1))

Épitope: C-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp OAS1 est non-conjugé

Application: Western Blotting (WB)

Specificité: OAS1 antibody was raised against the C terminal of OAS1

Purification: Affinity purified

Immunogène: OAS1 antibody was raised using the C terminal of OAS1 corresponding to a region with amino acids GWRQLAQEAEAWLNYPCFKNWDGSPVSSWILLVRPPASSLPFIPAPLHEA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

OAS1 Blocking Peptide, catalog no. 33R-3670, is also available for use as a blocking control in assays to test for specificity of this OAS1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OAS1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur OAS1

Antigène: OAS1 (2',5'-Oligoadenylate Synthetase 1, 40/46kDa (OAS1))

Autre désignation: OAS1 (OAS1 Produits)

Synonymes: anticorps OAS1, anticorps IFI-4, anticorps OIAS, anticorps OIASI, anticorps L3, anticorps Pp2a2, anticorps 2',5'-oligoadenylate synthetase 1, anticorps 2'-5'-oligoadenylate synthetase 1, anticorps 2'-5' oligoadenylate synthetase 1A, anticorps protein phosphatase 2 catalytic subunit beta, anticorps OAS1, anticorps Oas1a, anticorps Ppp2cb, anticorps Oas1

Sujet: OAS1 is a member of the 2-5A synthetase family, essential proteins involved in the innate immune response to viral infection. It is induced by interferons and uses adenosine triphosphate in 2'-specific nucleotidyl transfer reactions to synthesize 2',5'-oligoadenylates (2-5As). These molecules activate latent RNase L, which results in viral RNA degradation and the inhibition of viral replication. Mutations in this gene have been associated with host susceptibility to viral infection.

Poids moléculaire: 42 kDa (MW of target protein)

Pathways: Hepatitis C