OAS2 anticorps (Middle Region)
-
- Antigène Voir toutes OAS2 Anticorps
- OAS2 (2'-5'-Oligoadenylate Synthetase 2, 69/71kDa (OAS2))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp OAS2 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- OAS2 antibody was raised against the middle region of OAS2
- Purification
- Affinity purified
- Immunogène
- OAS2 antibody was raised using the middle region of OAS2 corresponding to a region with amino acids AKGTALKTGSDADLVVFHNSLKSYTSQKNERHKIVKEIHEQLKAFWREKE
- Top Product
- Discover our top product OAS2 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
OAS2 Blocking Peptide, catalog no. 33R-1294, is also available for use as a blocking control in assays to test for specificity of this OAS2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OAS2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- OAS2 (2'-5'-Oligoadenylate Synthetase 2, 69/71kDa (OAS2))
- Autre désignation
- OAS2 (OAS2 Produits)
- Synonymes
- anticorps Oasl11, anticorps 2'-5'-oligoadenylate synthetase 2, anticorps 2'-5' oligoadenylate synthetase 2, anticorps 2'-5'-oligoadenylate synthetase 2, 69/71kDa, anticorps OAS2, anticorps Oas2
- Sujet
- OAS2 is a member of the 2-5A synthetase family, essential proteins involved in the innate immune response to viral infection. It is induced by interferons and uses adenosine triphosphate in 2'-specific nucleotidyl transfer reactions to synthesize 2',5'-oligoadenylates (2-5As). These molecules activate latent RNase L, which results in viral RNA degradation and the inhibition of viral replication.
- Poids moléculaire
- 82 kDa (MW of target protein)
- Pathways
- Hepatitis C
-