ADRB1 anticorps (Middle Region)

N° du produit ABIN634512

Détail du produit anti-ADRB1 anticorps

Antigène: ADRB1 (Adrenergic, beta-1-, Receptor (ADRB1))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ADRB1 est non-conjugé

Application: Western Blotting (WB)

Specificité: ADRB1 antibody was raised against the middle region of ADRB1

Purification: Affinity purified

Immunogène: ADRB1 antibody was raised using the middle region of ADRB1 corresponding to a region with amino acids CTVWAISALVSFLPILMHWWRAESDEARRCYNDPKCCDFVTNRAYAIASS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ADRB1 Blocking Peptide, catalog no. 33R-1826, is also available for use as a blocking control in assays to test for specificity of this ADRB1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ADRB1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ADRB1

Antigène: ADRB1 (Adrenergic, beta-1-, Receptor (ADRB1))

Autre désignation: ADRB1 (ADRB1 Produits)

Synonymes: anticorps ADRB1R, anticorps B1AR, anticorps BETA1AR, anticorps RHR, anticorps RATB1AR, anticorps X-Beta1AR, anticorps BAR1, anticorps zgc:194728, anticorps zgc:194731, anticorps ADRB1, anticorps Adrb-1, anticorps beta-AR, anticorps adrenoceptor beta 1, anticorps adrenoceptor beta 1 L homeolog, anticorps adrenergic, beta-1-, receptor, anticorps adrenergic receptor, beta 1, anticorps ADRB1, anticorps Adrb1, anticorps adrb1.L, anticorps adrb1

Sujet: The adrenergic receptors (subtypes alpha 1, alpha 2, beta 1, and beta 2) are a prototypic family of guanine nucleotide binding regulatory protein-coupled receptors that mediate the physiological effects of the hormone epinephrine and the neurotransmitter norepinephrine. Specific polymorphisms in ADRB1 gene have been shown to affect the resting heart rate and can be involved in heart failure.

Poids moléculaire: 51 kDa (MW of target protein)

Pathways: cAMP Metabolic Process, Cellular Glucan Metabolic Process, Regulation of Muscle Cell Differentiation, Synaptic Membrane, Regulation of G-Protein Coupled Receptor Protein Signaling, G-protein mediated Events, Interaction of EGFR with phospholipase C-gamma, Brown Fat Cell Differentiation