KLRF1 anticorps (Middle Region)

N° du produit ABIN634539

Détail du produit anti-KLRF1 anticorps

Antigène: KLRF1 (Killer Cell Lectin-Like Receptor Subfamily F, Member 1 (KLRF1))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp KLRF1 est non-conjugé

Application: Western Blotting (WB)

Specificité: KLRF1 antibody was raised against the middle region of KLRF1

Purification: Affinity purified

Immunogène: KLRF1 antibody was raised using the middle region of KLRF1 corresponding to a region with amino acids QKGSCSNATQYEDTGDLKVNNGTRRNISNKDLCASRSADQTVLCQSEWLK

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

KLRF1 Blocking Peptide, catalog no. 33R-7602, is also available for use as a blocking control in assays to test for specificity of this KLRF1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KLRF1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur KLRF1

Antigène: KLRF1 (Killer Cell Lectin-Like Receptor Subfamily F, Member 1 (KLRF1))

Autre désignation: KLRF1 (KLRF1 Produits)

Synonymes: anticorps CLEC5C, anticorps NKp80, anticorps KLRF1, anticorps Lectin-like receptor F1, anticorps nkp80, anticorps killer cell lectin like receptor F1, anticorps KLRF1

Sujet: KLRF1, an activating homodimeric C-type lectin-like receptor (CTLR), is expressed on nearly all natural killer (NK) cells and stimulates their cytoxicity and cytokine release.

Poids moléculaire: 26 kDa (MW of target protein)