SSX2IP anticorps (Middle Region)
-
- Antigène Voir toutes SSX2IP Anticorps
- SSX2IP (Synovial Sarcoma, X Breakpoint 2 Interacting Protein (SSX2IP))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp SSX2IP est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- SSX2 IP antibody was raised against the middle region of SSX2 P
- Purification
- Affinity purified
- Immunogène
- SSX2 IP antibody was raised using the middle region of SSX2 P corresponding to a region with amino acids KVHLEGFNDEDVISRQDHEQETEKLELEIQQCKEMIKTQQQLLQQQLATA
- Top Product
- Discover our top product SSX2IP Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
SSX2IP Blocking Peptide, catalog no. 33R-4706, is also available for use as a blocking control in assays to test for specificity of this SSX2IP antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SSX0 P antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- SSX2IP (Synovial Sarcoma, X Breakpoint 2 Interacting Protein (SSX2IP))
- Autre désignation
- SSX2IP (SSX2IP Produits)
- Synonymes
- anticorps zgc:73314, anticorps MGC83757, anticorps ADIP, anticorps LCG, anticorps AU014939, anticorps AU042321, anticorps Adip, anticorps synovial sarcoma, X breakpoint 2 interacting protein a, anticorps synovial sarcoma, X breakpoint 2 interacting protein S homeolog, anticorps SSX family member 2 interacting protein, anticorps synovial sarcoma, X 2 interacting protein, anticorps ssx2ipa, anticorps ssx2ip.S, anticorps SSX2IP, anticorps Ssx2ip
- Sujet
- SSX2IP belongs to an adhesion system, which plays a role in the organization of homotypic, interneuronal and heterotypic cell-cell adherens junctions (AJs). It may connect the nectin-afadin and E-cadherin-catenin system through alpha-actinin and may be involved in organization of the actin cytoskeleton at AJs through afadin and alpha-actinin.
- Poids moléculaire
- 68 kDa (MW of target protein)
-