MYBPC2 anticorps (N-Term)
-
- Antigène Voir toutes MYBPC2 Anticorps
- MYBPC2 (Myosin Binding Protein C, Fast Type (MYBPC2))
-
Épitope
- N-Term
-
Reactivité
- Humain, Souris
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp MYBPC2 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- MYBPC2 antibody was raised against the N terminal of MYBPC2
- Purification
- Affinity purified
- Immunogène
- MYBPC2 antibody was raised using the N terminal of MYBPC2 corresponding to a region with amino acids KEAPPEDQSPTAEEPTGVFLKKPDSVSVETGKDAVVVAKVNGKELPDKPT
- Top Product
- Discover our top product MYBPC2 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
MYBPC2 Blocking Peptide, catalog no. 33R-4316, is also available for use as a blocking control in assays to test for specificity of this MYBPC2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MYBPC2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- MYBPC2 (Myosin Binding Protein C, Fast Type (MYBPC2))
- Autre désignation
- MYBPC2 (MYBPC2 Produits)
- Synonymes
- anticorps MYBPC, anticorps MYBPCF, anticorps im:7137115, anticorps im:7150089, anticorps zgc:110761, anticorps myosin binding protein C, fast-type, anticorps myosin binding protein C, fast type, anticorps myosin-binding protein C, fast-type, anticorps myosin binding protein C, fast type b, anticorps Mybpc2, anticorps MYBPC2, anticorps LOC520988, anticorps mybpc2b
- Sujet
- MYBPC2 encodes a member of the myosin-binding protein family C family. Myosin-binding protein C is a myosin-associated protein found in the cross-bridge-bearing zone (C region) of A bands in striated muscle. Mutations in this gene have been associated with hypertrophic cardiomyopathy.
- Poids moléculaire
- 128 kDa (MW of target protein)
-