MYBPC2 anticorps (N-Term)

N° du produit ABIN634628

Détail du produit anti-MYBPC2 anticorps

Antigène: MYBPC2 (Myosin Binding Protein C, Fast Type (MYBPC2))

Épitope: N-Term

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MYBPC2 est non-conjugé

Application: Western Blotting (WB)

Specificité: MYBPC2 antibody was raised against the N terminal of MYBPC2

Purification: Affinity purified

Immunogène: MYBPC2 antibody was raised using the N terminal of MYBPC2 corresponding to a region with amino acids KEAPPEDQSPTAEEPTGVFLKKPDSVSVETGKDAVVVAKVNGKELPDKPT

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MYBPC2 Blocking Peptide, catalog no. 33R-4316, is also available for use as a blocking control in assays to test for specificity of this MYBPC2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MYBPC2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MYBPC2

Antigène: MYBPC2 (Myosin Binding Protein C, Fast Type (MYBPC2))

Autre désignation: MYBPC2 (MYBPC2 Produits)

Synonymes: anticorps MYBPC, anticorps MYBPCF, anticorps im:7137115, anticorps im:7150089, anticorps zgc:110761, anticorps myosin binding protein C, fast-type, anticorps myosin binding protein C, fast type, anticorps myosin-binding protein C, fast-type, anticorps myosin binding protein C, fast type b, anticorps Mybpc2, anticorps MYBPC2, anticorps LOC520988, anticorps mybpc2b

Sujet: MYBPC2 encodes a member of the myosin-binding protein family C family. Myosin-binding protein C is a myosin-associated protein found in the cross-bridge-bearing zone (C region) of A bands in striated muscle. Mutations in this gene have been associated with hypertrophic cardiomyopathy.

Poids moléculaire: 128 kDa (MW of target protein)