HABP2 anticorps (Middle Region)
-
- Antigène Voir toutes HABP2 Anticorps
- HABP2 (Hyaluronan Binding Protein 2 (HABP2))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp HABP2 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- HABP2 antibody was raised against the middle region of HABP2
- Purification
- Affinity purified
- Immunogène
- HABP2 antibody was raised using the middle region of HABP2 corresponding to a region with amino acids EPSTKLPGFDSCGKTEIAERKIKRIYGGFKSTAGKHPWQASLQSSLPLTI
- Top Product
- Discover our top product HABP2 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
HABP2 Blocking Peptide, catalog no. 33R-2649, is also available for use as a blocking control in assays to test for specificity of this HABP2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HABP2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- HABP2 (Hyaluronan Binding Protein 2 (HABP2))
- Autre désignation
- HABP2 (HABP2 Produits)
- Synonymes
- anticorps HABP2, anticorps habp2, anticorps FSAP, anticorps HABP, anticorps HGFAL, anticorps PHBP, anticorps Fsap, anticorps Habp, anticorps Phbp, anticorps AI035669, anticorps hyaluronan binding protein 2, anticorps hyaluronic acid binding protein 2, anticorps HABP2, anticorps habp2, anticorps Habp2
- Sujet
- HABP2 is an extracellular serine protease that binds hyaluronic acid and is involved in cell adhesion. It is synthesized as a single chain, but then undergoes an autoproteolytic event to form the functional heterodimer. Further autoproteolysis leads to smaller, inactive peptides. This protease is known to cleave urinary plasminogen activator, coagulation factor VII, and the alpha and beta chains of fibrinogen, but not prothrombin, plasminogen, or the gamma chain of fibrinogen.
- Poids moléculaire
- 63 kDa (MW of target protein)
-