NEDD9 anticorps (Middle Region)

N° du produit ABIN634649

Détail du produit anti-NEDD9 anticorps

Antigène: NEDD9 (Neural Precursor Cell Expressed, Developmentally Down-Regulated 9 (NEDD9))

Épitope: Middle Region

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp NEDD9 est non-conjugé

Application: Western Blotting (WB)

Specificité: NEDD9 antibody was raised against the middle region of NEDD9

Purification: Affinity purified

Immunogène: NEDD9 antibody was raised using the middle region of NEDD9 corresponding to a region with amino acids DLVDGINRLSFSSTGSTRSNMSTSSTSSKESSLSASPAQDKRLFLDPDTA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

NEDD9 Blocking Peptide, catalog no. 33R-2070, is also available for use as a blocking control in assays to test for specificity of this NEDD9 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NEDD9 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur NEDD9

Antigène: NEDD9 (Neural Precursor Cell Expressed, Developmentally Down-Regulated 9 (NEDD9))

Autre désignation: NEDD9 (NEDD9 Produits)

Synonymes: anticorps NEDD9, anticorps CAS-L, anticorps CAS2, anticorps CASL, anticorps CASS2, anticorps HEF1, anticorps Cas-L, anticorps CasL, anticorps E230025G09Rik, anticorps neural precursor cell expressed, developmentally down-regulated 9, anticorps neural precursor cell expressed, developmentally down-regulated gene 9, anticorps NEDD9, anticorps Nedd9

Sujet: Variation in NEDD9 is associated wih susceptibility to late-onset Alzheimer and Parkinson diseases. Changes in expression of the scaffold protein HEF1/CAS-L/NEDD9 were found to be a potent prometastatic stimulus in melanoma and other cancers.

Poids moléculaire: 93 kDa (MW of target protein)