LGALS3BP anticorps (Middle Region)

N° du produit ABIN634658

Détail du produit anti-LGALS3BP anticorps

Antigène: LGALS3BP (Lectin, Galactoside-Binding, Soluble, 3 Binding Protein (LGALS3BP))

Épitope: Middle Region

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp LGALS3BP est non-conjugé

Application: Western Blotting (WB)

Specificité: LGALS3 BP antibody was raised against the middle region of LGALS3 P

Purification: Affinity purified

Immunogène: LGALS3 BP antibody was raised using the middle region of LGALS3 P corresponding to a region with amino acids NLSLYWSHEALFQKKTLQALEFHTVPFQLLARYKGLNLTEDTYKPRIYTS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

LGALS3BP Blocking Peptide, catalog no. 33R-6776, is also available for use as a blocking control in assays to test for specificity of this LGALS3BP antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LGALS0 P antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Références pour anticorps anti-LGALS3BP (ABIN634658)

Langley, Willeit, Didangelos, Matic, Skroblin, Barallobre-Barreiro, Lengquist, Rungger, Kapustin, Kedenko, Molenaar, Lu, Barwari, Suna, Yin, Iglseder, Paulweber, Willeit, Shalhoub, Pasterkamp, Davies et al.: "Extracellular matrix proteomics identifies molecular signature of symptomatic carotid plaques. ..." dans: The Journal of clinical investigation, Vol. 127, Issue 4, pp. 1546-1560, (2017) (PubMed).

Détails sur LGALS3BP

Antigène: LGALS3BP (Lectin, Galactoside-Binding, Soluble, 3 Binding Protein (LGALS3BP))

Autre désignation: LGALS3BP (LGALS3BP Produits)

Synonymes: anticorps 90K, anticorps BTBD17B, anticorps MAC-2-BP, anticorps TANGO10B, anticorps Ppicap, anticorps CyCAP, anticorps MAC-2BP, anticorps Tango10b, anticorps lgals3bp, anticorps zgc:136780, anticorps MAC2BP, anticorps Mac-2 BP, anticorps zgc:77059, anticorps galectin 3 binding protein, anticorps lectin, galactoside-binding, soluble, 3 binding protein, anticorps calcium activated nucleotidase 1, anticorps lectin, galactoside-binding, soluble, 3 binding protein a, anticorps lectin, galactoside-binding, soluble, 3 binding protein b, anticorps LGALS3BP, anticorps Lgals3bp, anticorps CANT1, anticorps lgals3bpa, anticorps lgals3bpb

Sujet: The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions. LGALS3BP has been found elevated in the serum of patients with cancer and in those infected by the human immunodeficiency virus (HIV). It appears to be implicated in immune response associated with natural killer (NK) and lymphokine-activated killer (LAK) cell cytotoxicity. The native protein binds specifically to a human macrophage-associated lectin known as Mac-2 and also binds galectin 1.

Poids moléculaire: 63 kDa (MW of target protein)