ATP2A2 anticorps (C-Term)
-
- Antigène Voir toutes ATP2A2 Anticorps
- ATP2A2 (ATPase, Ca++ Transporting, Cardiac Muscle, Slow Twitch 2 (ATP2A2))
-
Épitope
- C-Term
-
Reactivité
- Humain, Souris, Rat, Chien, Drosophila melanogaster
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp ATP2A2 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- ATP2 A2 antibody was raised against the C terminal of ATP2 2
- Purification
- Affinity purified
- Immunogène
- ATP2 A2 antibody was raised using the C terminal of ATP2 2 corresponding to a region with amino acids VNLVTDGLPATALGFNPPDLDIMNKPPRNPKEPLISGWLFFRYLAIGCYV
- Top Product
- Discover our top product ATP2A2 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
ATP2A2 Blocking Peptide, catalog no. 33R-9709, is also available for use as a blocking control in assays to test for specificity of this ATP2A2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ATP0 2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- ATP2A2 (ATPase, Ca++ Transporting, Cardiac Muscle, Slow Twitch 2 (ATP2A2))
- Autre désignation
- ATP2A2 (ATP2A2 Produits)
- Synonymes
- anticorps atp2b, anticorps ca-p60a, anticorps dar, anticorps serca2, anticorps ATP2A2, anticorps ATP2B, anticorps DAR, anticorps DD, anticorps SERCA2, anticorps SERCA2A, anticorps ATP2, anticorps Serca2, anticorps SercaII, anticorps 9530097L16Rik, anticorps D5Wsu150e, anticorps SERCA2B, anticorps mKIAA4195, anticorps atp2a2, anticorps zgc:55380, anticorps ATPase, Ca++ transporting, cardiac muscle, fast twitch 1 S homeolog, anticorps ATPase sarcoplasmic/endoplasmic reticulum Ca2+ transporting 2, anticorps ATPase, Ca++ transporting, cardiac muscle, slow twitch 2, anticorps ATPase, Ca++ transporting, cardiac muscle, slow twitch 2a, anticorps atp2a1.S, anticorps ATP2A2, anticorps Atp2a2, anticorps atp2a2a
- Sujet
- ATP2A2 is one of the SERCA Ca(2+)-ATPases, which are intracellular pumps located in the sarcoplasmic or endoplasmic reticula of muscle cells. This enzyme catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol into the sarcoplasmic reticulum lumen, and is involved in regulation of the contraction/relaxation cycle. Mutations in this gene cause Darier-White disease, also known as keratosis follicularis, an autosomal dominant skin disorder characterized by loss of adhesion between epidermal cells and abnormal keratinization. Alternative splicing results in multiple transcript variants encoding different isoforms.
- Poids moléculaire
- 115 kDa (MW of target protein)
- Pathways
- Myometrial Relaxation and Contraction, ER-Nucleus Signaling, Ribonucleoside Biosynthetic Process
-