Claudin 15 anticorps (Middle Region)

N° du produit ABIN634748

Détail du produit anti-Claudin 15 anticorps

Antigène: Claudin 15 (CLDN15)

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Claudin 15 est non-conjugé

Application: Western Blotting (WB)

Specificité: Claudin 15 antibody was raised against the middle region of CLDN15

Purification: Affinity purified

Immunogène: Claudin 15 antibody was raised using the middle region of CLDN15 corresponding to a region with amino acids LSGYIQACRALMITAILLGFLGLLLGIAGLRCTNIGGLELSRKAKLAATA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Claudin 15 Blocking Peptide, catalog no. 33R-5429, is also available for use as a blocking control in assays to test for specificity of this Claudin 15 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CLDN15 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Claudin 15

Antigène: Claudin 15 (CLDN15)

Autre désignation: Claudin 15 (CLDN15 Produits)

Synonymes: anticorps CLDN15, anticorps cldn15, anticorps cldn15l, anticorps zgc:63943, anticorps zgc:136755, anticorps 2210009B08Rik, anticorps BB107105, anticorps claudin 15, anticorps claudin 15a, anticorps claudin 15b, anticorps Cldn15, anticorps CLDN15, anticorps cldn15a, anticorps cldn15b

Sujet: CLDN15 plays a major role in tight junction-specific obliteration of the intercellular space, through calcium-independent cell-adhesion activity.

Poids moléculaire: 24 kDa (MW of target protein)

Pathways: Cell-Cell Junction Organization, Hepatitis C