CD5 anticorps (N-Term)
-
- Antigène Voir toutes CD5 Anticorps
- CD5
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp CD5 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- CD5 antibody was raised against the N terminal of CD5
- Purification
- Affinity purified
- Immunogène
- CD5 antibody was raised using the N terminal of CD5 corresponding to a region with amino acids MPMGSLQPLATLYLLGMLVASCLGRLSWYDPDFQARLTRSNSKCQGQLEV
- Top Product
- Discover our top product CD5 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
CD5 Blocking Peptide, catalog no. 33R-6297, is also available for use as a blocking control in assays to test for specificity of this CD5 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CD5 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- CD5
- Autre désignation
- CD5 (CD5 Produits)
- Synonymes
- anticorps CD5, anticorps Ly-1, anticorps Ly-12, anticorps Ly-A, anticorps Lyt-1, anticorps LEU1, anticorps T1, anticorps CD5 molecule, anticorps CD5 antigen, anticorps CD5 molecule like, anticorps Cd5 molecule, anticorps CD5, anticorps Cd5, anticorps CD5L
- Sujet
- CD5 may act as a receptor in regulating T-cell proliferation. CD5 interacts with CD72/LYB-2.
- Poids moléculaire
- 54 kDa (MW of target protein)
-