M-CSF/CSF1 anticorps

N° du produit ABIN634814

Détail du produit anti-M-CSF/CSF1 anticorps

Antigène: M-CSF/CSF1 (CSF1) (Colony Stimulating Factor 1 (Macrophage) (CSF1))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp M-CSF/CSF1 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: CSF1 antibody was raised using a synthetic peptide corresponding to a region with amino acids PPTTWLGSLLLLVCLLASRSITEEVSEYCSHMIGSGHLQSLQRLIDSQME

Information d'application

Indications d'application: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CSF1 Blocking Peptide, catalog no. 33R-7283, is also available for use as a blocking control in assays to test for specificity of this CSF1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CSF1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur M-CSF/CSF1

Antigène: M-CSF/CSF1 (CSF1) (Colony Stimulating Factor 1 (Macrophage) (CSF1))

Autre désignation: CSF1 (CSF1 Produits)

Synonymes: anticorps CSF-1, anticorps MCSF, anticorps C87615, anticorps Csfm, anticorps op, anticorps csf1-1, anticorps zgc:172186, anticorps CSF1, anticorps csf1-2, anticorps zgc:158436, anticorps colony stimulating factor 1, anticorps colony stimulating factor 1 (macrophage), anticorps colony stimulating factor 1a (macrophage), anticorps macrophage colony-stimulating factor 1, anticorps macrophage colony stimulating factor, anticorps colony stimulating factor 1b (macrophage), anticorps CSF1, anticorps Csf1, anticorps csf1a, anticorps LOC396599, anticorps LOC100860895, anticorps csf1b

Sujet: CSF1 is a cytokine that controls the production, differentiation, and function of macrophages. The active form of the protein is found extracellularly as a disulfide-linked homodimer, and is thought to be produced by proteolytic cleavage of membrane-bound precursors. CSF1 may be involved in development of the placenta.

Poids moléculaire: 45 kDa (MW of target protein)

Pathways: Signalisation RTK