ABCC9 anticorps

N° du produit ABIN634823

Détail du produit anti-ABCC9 anticorps

Antigène: ABCC9 (ATP-Binding Cassette, Sub-Family C (CFTR/MRP), Member 9 (ABCC9))

Reactivité: Souris, Humain, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ABCC9 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: ABCC9 antibody was raised using a synthetic peptide corresponding to a region with amino acids AVVTEGGENFSVGQRQLFCLARAFVRKSSILIMDEATASIDMATENILQK

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ABCC9 Blocking Peptide, catalog no. 33R-1620, is also available for use as a blocking control in assays to test for specificity of this ABCC9 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ABCC9 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ABCC9

Antigène: ABCC9 (ATP-Binding Cassette, Sub-Family C (CFTR/MRP), Member 9 (ABCC9))

Autre désignation: ABCC9 (ABCC9 Produits)

Synonymes: anticorps SUR2B, anticorps DDBDRAFT_0215814, anticorps DDBDRAFT_0216237, anticorps DDB_0215814, anticorps DDB_0216237, anticorps si:dkey-183c2.3, anticorps sur2, anticorps ABC37, anticorps ATFB12, anticorps CANTU, anticorps CMD1O, anticorps SUR2, anticorps SUR2A, anticorps AI414027, anticorps AI449286, anticorps Sur2, anticorps ABCC9, anticorps ATP binding cassette subfamily C member 9, anticorps ATP-binding cassette sub-family C member 8, anticorps ABC transporter C family protein, anticorps ATP-binding cassette sub-family C member 9, anticorps ATP-binding cassette, sub-family C (CFTR/MRP), member 9, anticorps ABCC9, anticorps LOC581821, anticorps abcC9, anticorps LOC100470981, anticorps abcc9, anticorps Abcc9

Sujet: ABCC9 is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MRP subfamily which is involved in multi-drug resistance. This protein is thought to form ATP-sensitive potassium channels in cardiac, skeletal, and vascular and non-vascular smooth muscle.

Poids moléculaire: 174 kDa (MW of target protein)