ATP2A1/SERCA1 anticorps (N-Term)
-
- Antigène Voir toutes ATP2A1/SERCA1 (ATP2A1) Anticorps
- ATP2A1/SERCA1 (ATP2A1) (ATPase, Ca++ Transporting, Cardiac Muscle, Fast Twitch 1 (ATP2A1))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp ATP2A1/SERCA1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- ATP2 A1 antibody was raised against the N terminal of ATP2 1
- Purification
- Affinity purified
- Immunogène
- ATP2 A1 antibody was raised using the N terminal of ATP2 1 corresponding to a region with amino acids MEAAHAKTTEECLAYFGVSETTGLTPDQVKRNLEKYGLNELPAEEGKTLW
- Top Product
- Discover our top product ATP2A1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
ATP2A1 Blocking Peptide, catalog no. 33R-5884, is also available for use as a blocking control in assays to test for specificity of this ATP2A1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ATP0 1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- ATP2A1/SERCA1 (ATP2A1) (ATPase, Ca++ Transporting, Cardiac Muscle, Fast Twitch 1 (ATP2A1))
- Autre désignation
- ATP2A1 (ATP2A1 Produits)
- Synonymes
- anticorps cb279, anticorps serca, anticorps serca1, anticorps wu:cegs655, anticorps wu:fb17h11, anticorps wu:fb19b10, anticorps zgc:92110, anticorps ATP2A1, anticorps atp2a, anticorps atp2a2, anticorps atp2b, anticorps ca-p60a, anticorps dar, anticorps serca2, anticorps SERCA1, anticorps ATP2A3, anticorps SERCA1a, anticorps Serca1, anticorps ATP2A, anticorps ATPase, Ca++ transporting, cardiac muscle, fast twitch 1, anticorps ATPase sarcoplasmic/endoplasmic reticulum Ca2+ transporting 1, anticorps ATPase, Ca++ transporting, cardiac muscle, slow twitch 2 S homeolog, anticorps atp2a1, anticorps ATP2A1, anticorps atp2a2.S, anticorps Atp2a1
- Sujet
- This gene encodes one of the SERCA Ca(2+)-ATPases, which are intracellular pumps located in the sarcoplasmic or endoplasmic reticula of muscle cells.
- Poids moléculaire
- 109 kDa (MW of target protein)
- Pathways
- Ribonucleoside Biosynthetic Process
-