SLC22A14 anticorps (N-Term)
-
- Antigène Voir toutes SLC22A14 Anticorps
- SLC22A14 (Solute Carrier Family 22 (Organic Cation Transporter), Member 14 (SLC22A14))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp SLC22A14 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- SLC22 A14 antibody was raised against the N terminal of SLC22 14
- Purification
- Affinity purified
- Immunogène
- SLC22 A14 antibody was raised using the N terminal of SLC22 14 corresponding to a region with amino acids IIQFGLNDTDTCQDGWIYPDAKKRSLINEFDLVCGMETKKDTAQIMFMAG
- Top Product
- Discover our top product SLC22A14 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
SLC22A14 Blocking Peptide, catalog no. 33R-4005, is also available for use as a blocking control in assays to test for specificity of this SLC22A14 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 14 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- SLC22A14 (Solute Carrier Family 22 (Organic Cation Transporter), Member 14 (SLC22A14))
- Autre désignation
- SLC22A14 (SLC22A14 Produits)
- Synonymes
- anticorps Gm1128, anticorps OCTL2, anticorps OCTL4, anticorps ORCTL4, anticorps solute carrier family 22, member 14, anticorps solute carrier family 22 member 14, anticorps solute carrier family 22 (organic cation transporter), member 14, anticorps Slc22a14, anticorps SLC22A14
- Sujet
- SLC22A14 is a member of the organic-cation transporter family. SLC22A14 is a transmembrane protein which is thought to transport small molecules and since this protein is conserved among several species, it is suggested to have a fundamental role in mammalian systems.
- Poids moléculaire
- 67 kDa (MW of target protein)
-