SEC22C anticorps
-
- Antigène Voir toutes SEC22C Anticorps
- SEC22C (SEC22 Vesicle Trafficking Protein Homolog C (SEC22C))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp SEC22C est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- SEC22 C antibody was raised using a synthetic peptide corresponding to a region with amino acids FRMEPVTALGILSLILNIMCAALNLIRGVHLAEHSLQVAHEEIGNILAFL
- Top Product
- Discover our top product SEC22C Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
SEC22C Blocking Peptide, catalog no. 33R-3053, is also available for use as a blocking control in assays to test for specificity of this SEC22C antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SEC20 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- SEC22C (SEC22 Vesicle Trafficking Protein Homolog C (SEC22C))
- Autre désignation
- SEC22C (SEC22C Produits)
- Synonymes
- anticorps 4932412K21, anticorps 5930407I15Rik, anticorps C530046H07, anticorps Sec22l3, anticorps SEC22L3, anticorps SEC22 homolog C, vesicle trafficking protein, anticorps Sec22c, anticorps SEC22C
- Sujet
- The protein encoded by this gene is a member of the SEC22 family of vesicle trafficking proteins. It is localized at the endoplasmic reticulum and it is thought to play a role in the early stages of the ER-Golgi protein trafficking.
- Poids moléculaire
- 34 kDa (MW of target protein)
-