Tel:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@anticorps-enligne.fr

PTPLAD2 anticorps (Protein tyrosine Phosphatase-Like A Domain Containing 2) (Middle Region) Primary Antibody

PTPLAD2 Reactivité: Humain WB Hôte: Lapin Polyclonal
N° du produit ABIN634888
$647.32
Plus shipping costs $45.00
50 μg
local_shipping Destination: Etats-Unis
Envoi sous 9 à 11 jours ouvrables
  • Antigène
    Épitope
    Middle Region
    Reactivité
    Humain
    Hôte
    Lapin
    Clonalité
    Polyclonal
    Application
    Western Blotting (WB)
    Specificité
    PTPLAD2 antibody was raised against the middle region of PTPLAD2
    Purification
    Affinity purified
    Immunogène
    PTPLAD2 antibody was raised using the middle region of PTPLAD2 corresponding to a region with amino acids LLHIYVGIESNHLLPRFLQLTERIIILFVVITSQEEVQEKYVVCVLFVFW
  • Indications d'application
    WB: 1 µg/mL
    Optimal conditions should be determined by the investigator.
    Commentaires

    PTPLAD2 Blocking Peptide, catalog no. 33R-5146, is also available for use as a blocking control in assays to test for specificity of this PTPLAD2 antibody

    Restrictions
    For Research Use only
  • Format
    Lyophilized
    Reconstitution
    Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PTPLAD2 antibody in PBS
    Concentration
    Lot specific
    Buffer
    PBS
    Conseil sur la manipulation
    Avoid repeated freeze/thaw cycles.
    Dilute only prior to immediate use.
    Stock
    4 °C
    Stockage commentaire
    Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
  • Antigène
    Autre désignation
    PTPLAD2 (PTPLAD2 Antibody Extrait)
    Sujet
    PTPLAD2 is a multi-pass membrane protein. It belongs to the PTPLA family. The function of the PTPLAD2 protein remains unknown.
    Poids moléculaire
    27 kDa (MW of target protein)
Vous êtes ici: