DISP1 anticorps

N° du produit ABIN634914

Détail du produit anti-DISP1 anticorps

Antigène: DISP1 (Dispatched Homolog 1 (DISP1))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp DISP1 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: DISP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids FVLCDVWNYTKFDKPHAETSETVSITLQHAALSMFVTSFTTAAAFYANYV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

DISP1 Blocking Peptide, catalog no. 33R-3115, is also available for use as a blocking control in assays to test for specificity of this DISP1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DISP1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur DISP1

Antigène: DISP1 (Dispatched Homolog 1 (DISP1))

Autre désignation: DISP1 (DISP1 Produits)

Synonymes: anticorps DISP1, anticorps DISPA, anticorps 1190008H24Rik, anticorps DispA, anticorps con, anticorps zgc:111866, anticorps dispatched, anticorps dispatched RND transporter family member 1, anticorps dispatched homolog 1 (Drosophila), anticorps CpipJ_CPIJ008642, anticorps DISP1, anticorps Disp1, anticorps disp1

Sujet: DISP1 functions in hedgehog (Hh) signaling. Regulates the release and extracellular accumulation of cholesterol-modified hedgehog proteins and is hence required for effective production of the Hh signal. The pattern of cellular proliferation and differentiation that leads to normal development of embryonic structures often depends upon the localized production of secreted protein signals. Cells surrounding the source of a particular signal respond in a graded manner according to the effective concentration of the signal, and this response produces the pattern of cell types constituting the mature structure.

Poids moléculaire: 171 kDa (MW of target protein)

Pathways: Signalisation Hedgehog