ZDHHC19 anticorps (N-Term)
-
- Antigène Tous les produits ZDHHC19
- ZDHHC19 (Zinc Finger, DHHC-Type Containing 19 (ZDHHC19))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp ZDHHC19 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- ZDHHC19 antibody was raised against the N terminal of ZDHHC19
- Purification
- Affinity purified
- Immunogène
- ZDHHC19 antibody was raised using the N terminal of ZDHHC19 corresponding to a region with amino acids TLLTDATPLVKEPHPLPLVPRPWFLPSLFAAFNVVLLVFFSGLFFAFPCR
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
ZDHHC19 Blocking Peptide, catalog no. 33R-9177, is also available for use as a blocking control in assays to test for specificity of this ZDHHC19 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ZDHHC19 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- ZDHHC19 (Zinc Finger, DHHC-Type Containing 19 (ZDHHC19))
- Autre désignation
- ZDHHC19 (ZDHHC19 Produits)
- Synonymes
- anticorps RGD1560310, anticorps Gm1744, anticorps Gm616, anticorps DHHC19, anticorps zinc finger, DHHC-type containing 19, anticorps zinc finger DHHC-type containing 19, anticorps zinc finger, DHHC domain containing 19, anticorps Zdhhc19, anticorps ZDHHC19
- Sujet
- ZDHHC19 belongs to the DHHC palmitoyltransferase family. It contains 1 DHHC-type zinc finger. ZDHHC19 is a multi-pass membrane protein. The function of the ZDHHC19 protein is not known.
- Poids moléculaire
- 34 kDa (MW of target protein)
-