ZDHHC19 anticorps (N-Term)

N° du produit ABIN634916

Détail du produit anti-ZDHHC19 anticorps

Antigène: ZDHHC19 (Zinc Finger, DHHC-Type Containing 19 (ZDHHC19))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ZDHHC19 est non-conjugé

Application: Western Blotting (WB)

Specificité: ZDHHC19 antibody was raised against the N terminal of ZDHHC19

Purification: Affinity purified

Immunogène: ZDHHC19 antibody was raised using the N terminal of ZDHHC19 corresponding to a region with amino acids TLLTDATPLVKEPHPLPLVPRPWFLPSLFAAFNVVLLVFFSGLFFAFPCR

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ZDHHC19 Blocking Peptide, catalog no. 33R-9177, is also available for use as a blocking control in assays to test for specificity of this ZDHHC19 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ZDHHC19 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ZDHHC19

Antigène: ZDHHC19 (Zinc Finger, DHHC-Type Containing 19 (ZDHHC19))

Autre désignation: ZDHHC19 (ZDHHC19 Produits)

Synonymes: anticorps RGD1560310, anticorps Gm1744, anticorps Gm616, anticorps DHHC19, anticorps zinc finger, DHHC-type containing 19, anticorps zinc finger DHHC-type containing 19, anticorps zinc finger, DHHC domain containing 19, anticorps Zdhhc19, anticorps ZDHHC19

Sujet: ZDHHC19 belongs to the DHHC palmitoyltransferase family. It contains 1 DHHC-type zinc finger. ZDHHC19 is a multi-pass membrane protein. The function of the ZDHHC19 protein is not known.

Poids moléculaire: 34 kDa (MW of target protein)