RNF144B anticorps (Middle Region)

N° du produit ABIN634924

Détail du produit anti-RNF144B anticorps

Antigène: RNF144B (Ring Finger Protein 144B (RNF144B))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RNF144B est non-conjugé

Application: Western Blotting (WB)

Specificité: RNF144 B antibody was raised against the middle region of RNF144

Purification: Affinity purified

Immunogène: RNF144 B antibody was raised using the middle region of RNF144 corresponding to a region with amino acids KHTFCWYCLQNLDNDIFLRHYDKGPCRNKLGHSRASVMWNRTQVVGILVG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RNF144B Blocking Peptide, catalog no. 33R-4424, is also available for use as a blocking control in assays to test for specificity of this RNF144B antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RNF140 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RNF144B

Antigène: RNF144B (Ring Finger Protein 144B (RNF144B))

Autre désignation: RNF144B (RNF144B Produits)

Synonymes: anticorps IBRDC2, anticorps PIR2, anticorps bA528A10.3, anticorps p53RFP, anticorps BC025007, anticorps E130105P19Rik, anticorps Ibrdc2, anticorps Pir2, anticorps ring finger protein 144B, anticorps RNF144B, anticorps Rnf144b

Sujet: RNF144B is an E3 ubiquitin-protein ligase which accepts ubiquitin from E2 ubiquitin-conjugating enzymes UBE2L3 and UBE2L6 in the form of a thioester and then directly transfers the ubiquitin to targeted substrates such as LCMT2.

Poids moléculaire: 34 kDa (MW of target protein)