FJX1 anticorps
-
- Antigène Voir toutes FJX1 Anticorps
- FJX1 (Four Jointed Box 1 (FJX1))
-
Reactivité
- Humain, Rat, Souris
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp FJX1 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- FJX1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MVALERGGCGRSSNRLARFADGTRACVRYGINPEQIQGEALSYYLARLLG
- Top Product
- Discover our top product FJX1 Anticorps primaire
-
-
- Indications d'application
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
FJX1 Blocking Peptide, catalog no. 33R-6577, is also available for use as a blocking control in assays to test for specificity of this FJX1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FJX1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- FJX1 (Four Jointed Box 1 (FJX1))
- Autre désignation
- FJX1 (FJX1 Produits)
- Synonymes
- anticorps four jointed box 1, anticorps four jointed box 1 (Drosophila), anticorps FJX1, anticorps Fjx1
- Sujet
- FJX1 is the human ortholog of mouse and Drosophila four-jointed gene product. The Drosophila protein is important for growth and differentiation of legs and wings, and for proper development of the eyes. The exact function of FJX1 gene in humans is not known.
- Poids moléculaire
- 48 kDa (MW of target protein)
-