STYK1 anticorps (C-Term)

N° du produit ABIN634962

Détail du produit anti-STYK1 anticorps

Antigène: STYK1 (serine/threonine/tyrosine Kinase 1 (STYK1))

Épitope: C-Term

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp STYK1 est non-conjugé

Application: Western Blotting (WB)

Specificité: STYK1 antibody was raised against the C terminal of STYK1

Purification: Affinity purified

Immunogène: STYK1 antibody was raised using the C terminal of STYK1 corresponding to a region with amino acids PERLLLRPASIRADVWSFGILLYEMVTLGAPPYPEVPPTSILEHLQRRKI

Information d'application

Indications d'application: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

STYK1 Blocking Peptide, catalog no. 33R-7060, is also available for use as a blocking control in assays to test for specificity of this STYK1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of STYK1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur STYK1

Antigène: STYK1 (serine/threonine/tyrosine Kinase 1 (STYK1))

Autre désignation: STYK1 (STYK1 Produits)

Synonymes: anticorps wu:fc39b09, anticorps wu:fe11d05, anticorps STYK1, anticorps NOK, anticorps SuRTK106, anticorps 9130025L13, anticorps AI326477, anticorps Nok, anticorps RGD1564211, anticorps serine/threonine/tyrosine kinase 1, anticorps STYK1, anticorps styk1, anticorps Styk1

Sujet: Receptor protein tyrosine kinases, like STYK1, play important roles in diverse cellular and developmental processes, such as cell proliferation, differentiation, and survival.

Poids moléculaire: 47 kDa (MW of target protein)