SLC25A24 anticorps
-
- Antigène Voir toutes SLC25A24 Anticorps
- SLC25A24 (Solute Carrier Family 25 (Mitochondrial Carrier, Phosphate Carrier), Member 24 (SLC25A24))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp SLC25A24 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- SLC25 A24 antibody was raised using a synthetic peptide corresponding to a region with amino acids MDSLYGDLFWYLDYNKDGTLDIFELQEGLEDVGAIQSLEEAKKIFTTGDV
- Top Product
- Discover our top product SLC25A24 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
SLC25A24 Blocking Peptide, catalog no. 33R-5869, is also available for use as a blocking control in assays to test for specificity of this SLC25A24 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 24 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- SLC25A24 (Solute Carrier Family 25 (Mitochondrial Carrier, Phosphate Carrier), Member 24 (SLC25A24))
- Autre désignation
- SLC25A24 (SLC25A24 Produits)
- Synonymes
- anticorps SLC25A24, anticorps 2610016M12Rik, anticorps apc1, anticorps scamc-1, anticorps scamc1-A, anticorps slc25a24, anticorps APC1, anticorps SCAMC-1, anticorps EFINAL, anticorps SCAMC1, anticorps calcium-binding mitochondrial carrier protein SCaMC-1-like, anticorps solute carrier family 25 (mitochondrial carrier, phosphate carrier), member 24, anticorps solute carrier family 25 member 24, anticorps solute carrier family 25 (mitochondrial carrier; phosphate carrier), member 24 L homeolog, anticorps solute carrier family 25 (mitochondrial carrier; phosphate carrier), member 24, anticorps LOC534742, anticorps Slc25a24, anticorps slc25a24.L, anticorps SLC25A24, anticorps slc25a24
- Sujet
- SLC25A24 is a calcium-dependent mitochondrial solute carrier. Mitochondrial solute carriers shuttle metabolites, nucleotides, and cofactors through the mitochondrial inner membrane. It may act as a ATP-Mg/Pi exchanger.
- Poids moléculaire
- 51 kDa (MW of target protein)
-