SLC25A31 anticorps
-
- Antigène Voir toutes SLC25A31 Anticorps
- SLC25A31 (Solute Carrier Family 25 (Mitochondrial Carrier, Adenine Nucleotide Translocator), Member 31 (SLC25A31))
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp SLC25A31 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- SLC25 A31 antibody was raised using a synthetic peptide corresponding to a region with amino acids LAGGVAAAVSKTAVAPIERVKLLLQVQASSKQISPEARYKGMVDCLVRIP
- Top Product
- Discover our top product SLC25A31 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
SLC25A31 Blocking Peptide, catalog no. 33R-4767, is also available for use as a blocking control in assays to test for specificity of this SLC25A31 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 31 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- SLC25A31 (Solute Carrier Family 25 (Mitochondrial Carrier, Adenine Nucleotide Translocator), Member 31 (SLC25A31))
- Autre désignation
- SLC25A31 (SLC25A31 Produits)
- Synonymes
- anticorps AAC4, anticorps ANT4, anticorps SFEC35kDa, anticorps 1700034J06Rik, anticorps Ant4, anticorps Sfec, anticorps solute carrier family 25 member 31, anticorps solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 31, anticorps SLC25A31, anticorps Slc25a31
- Sujet
- Mitochondrial ADP/ATP carriers, such as SLC25A31, are nuclear-coded mitochondrial proteins that catalyze the exchange of ATP generated in mitochondria by ATP synthase against ADP produced in cytosol by most energy-consuming reactions.
- Poids moléculaire
- 35 kDa (MW of target protein)
-