GPRC5A anticorps (C-Term)
-
- Antigène Voir toutes GPRC5A Anticorps
- GPRC5A (G Protein-Coupled Receptor, Family C, Group 5, Member A (GPRC5A))
-
Épitope
- C-Term
-
Reactivité
- Humain, Souris
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp GPRC5A est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- GPCR5 A antibody was raised against the C terminal Of Gpcr5
- Purification
- Affinity purified
- Immunogène
- GPCR5 A antibody was raised using the C terminal Of Gpcr5 corresponding to a region with amino acids SQEEITQGFEETGDTLYAPYSTHFQLQNQPPQKEFSIPRAHAWPSPYKDY
- Top Product
- Discover our top product GPRC5A Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
GPCR5A Blocking Peptide, catalog no. 33R-8711, is also available for use as a blocking control in assays to test for specificity of this GPCR5A antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GPCR0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- GPRC5A (G Protein-Coupled Receptor, Family C, Group 5, Member A (GPRC5A))
- Autre désignation
- GPCR5A (GPRC5A Produits)
- Synonymes
- anticorps GPCR5A, anticorps RAI3, anticorps RAIG1, anticorps Rai3, anticorps Raig1, anticorps G protein-coupled receptor class C group 5 member A, anticorps G protein-coupled receptor, family C, group 5, member A, anticorps G protein-coupled receptor, class C, group 5, member A, anticorps GPRC5A, anticorps Gprc5a
- Sujet
- GPCR5A is a member of the type 3 G protein-coupling receptor family, characterized by the signature 7-transmembrane domain motif. The protein may be involved in interaction between retinoid acid and G protein signalling pathways. Retinoic acid plays a critical role in development, cellular growth, and differentiation. Its gene may play a role in embryonic development and epithelial cell differentiation.
- Poids moléculaire
- 39 kDa (MW of target protein)
-